PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1KG488700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NF-YB
Protein Properties Length: 266aa    MW: 28058.1 Da    PI: 7.0331
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1KG488700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB171.11.3e-5331126297
                NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                          reqdr++Pianv+rim++vlP +akis+daket+qecvse+isf+t+ea+++cqre+rkti+++d+lwa++ lGf+dyvepl+vyl++yr
  Pavir.1KG488700.1.p  31 REQDRLMPIANVIRIMRRVLPPHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSRLGFDDYVEPLSVYLHRYR 120
                          89**************************************************************************************** PP

                NF-YB  92 elegek 97 
                          e+ege 
  Pavir.1KG488700.1.p 121 EFEGEA 126
                          ***985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.7E-4924128IPR009072Histone-fold
SuperFamilySSF471139.67E-3833130IPR009072Histone-fold
PfamPF008083.2E-2537100IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006158.2E-176482No hitNo description
PROSITE patternPS0068506783IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006158.2E-1783101No hitNo description
PRINTSPR006158.2E-17102120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MDSASGFLPA GAANGSGSGG GGQQQAAAPI REQDRLMPIA NVIRIMRRVL PPHAKISDDA  60
KETIQECVSE YISFITGEAN ERCQREQRKT ITAEDVLWAM SRLGFDDYVE PLSVYLHRYR  120
EFEGEARGVV GLATPGAARG GDHHHPSMAL KSRAPGAMAQ HHHDMQMHAS MYRAPAVLPP  180
GAPHHGHGFV SMPHHGGGGH QYLPYPYEAA YAGEHAMAAY YGSAAAYGAP GNGGSGDGSG  240
SSGGSASRTP QGGSFEHQHP FASYK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B8e-4030121192Transcription factor HapC (Eurofung)
4g92_B8e-4030121192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2432570.0AC243257.1 Panicum virgatum clone PV_ABa103-H05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953763.11e-111PREDICTED: nuclear transcription factor Y subunit B-2
TrEMBLK3Z0M51e-111K3Z0M5_SETIT; Uncharacterized protein
STRINGSi020091m1e-111(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.21e-62nuclear factor Y, subunit B6